Anti C17orf97 pAb (ATL-HPA023583)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023583-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C17orf97
Alternative Gene Name: LOC400566
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053783: 52%, ENSRNOG00000025287: 53%
Entrez Gene ID: 400566
Uniprot ID: Q6ZQX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP |
Gene Sequence | SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP |
Gene ID - Mouse | ENSMUSG00000053783 |
Gene ID - Rat | ENSRNOG00000025287 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C17orf97 pAb (ATL-HPA023583) | |
Datasheet | Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link) |
Vendor Page | Anti C17orf97 pAb (ATL-HPA023583) at Atlas Antibodies |
Documents & Links for Anti C17orf97 pAb (ATL-HPA023583) | |
Datasheet | Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link) |
Vendor Page | Anti C17orf97 pAb (ATL-HPA023583) |
Citations for Anti C17orf97 pAb (ATL-HPA023583) – 1 Found |
Brower, Christopher S; Rosen, Connor E; Jones, Richard H; Wadas, Brandon C; Piatkov, Konstantin I; Varshavsky, Alexander. Liat1, an arginyltransferase-binding protein whose evolution among primates involved changes in the numbers of its 10-residue repeats. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2014;111(46):E4936-45. PubMed |