Anti C17orf97 pAb (ATL-HPA023583)

Atlas Antibodies

Catalog No.:
ATL-HPA023583-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 97
Gene Name: C17orf97
Alternative Gene Name: LOC400566
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053783: 52%, ENSRNOG00000025287: 53%
Entrez Gene ID: 400566
Uniprot ID: Q6ZQX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP
Gene Sequence SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP
Gene ID - Mouse ENSMUSG00000053783
Gene ID - Rat ENSRNOG00000025287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C17orf97 pAb (ATL-HPA023583)
Datasheet Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link)
Vendor Page Anti C17orf97 pAb (ATL-HPA023583) at Atlas Antibodies

Documents & Links for Anti C17orf97 pAb (ATL-HPA023583)
Datasheet Anti C17orf97 pAb (ATL-HPA023583) Datasheet (External Link)
Vendor Page Anti C17orf97 pAb (ATL-HPA023583)
Citations for Anti C17orf97 pAb (ATL-HPA023583) – 1 Found
Brower, Christopher S; Rosen, Connor E; Jones, Richard H; Wadas, Brandon C; Piatkov, Konstantin I; Varshavsky, Alexander. Liat1, an arginyltransferase-binding protein whose evolution among primates involved changes in the numbers of its 10-residue repeats. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2014;111(46):E4936-45.  PubMed