Anti C17orf80 pAb (ATL-HPA012896)

Atlas Antibodies

Catalog No.: ATL-HPA012896-100

Protein Description: chromosome 17 open reading frame 80
Gene Name: C17orf80
Alternative Gene Name: FLJ20721, HLC-8, MIG3, SPEP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041623: 51%, ENSRNOG00000024780: 52%
Entrez Gene ID: 55028
Uniprot ID: Q9BSJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLILSLKMSSLGKIQVM
• Gene Sequence: AGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLILSLKMSSLGKIQVM
• Gene ID - Mouse: ENSMUSG00000041623
• Gene ID - Rat: ENSRNOG00000024780
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.