Anti C17orf75 pAb (ATL-HPA004061)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004061-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C17orf75
Alternative Gene Name: NJMU-R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057181: 84%, ENSRNOG00000000237: 83%
Entrez Gene ID: 64149
Uniprot ID: Q9HAS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI |
Gene Sequence | PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI |
Gene ID - Mouse | ENSMUSG00000057181 |
Gene ID - Rat | ENSRNOG00000000237 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C17orf75 pAb (ATL-HPA004061) | |
Datasheet | Anti C17orf75 pAb (ATL-HPA004061) Datasheet (External Link) |
Vendor Page | Anti C17orf75 pAb (ATL-HPA004061) at Atlas Antibodies |
Documents & Links for Anti C17orf75 pAb (ATL-HPA004061) | |
Datasheet | Anti C17orf75 pAb (ATL-HPA004061) Datasheet (External Link) |
Vendor Page | Anti C17orf75 pAb (ATL-HPA004061) |
Citations for Anti C17orf75 pAb (ATL-HPA004061) – 1 Found |
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |