Anti C17orf75 pAb (ATL-HPA004061)

Atlas Antibodies

SKU: ATL-HPA004061-25

• 
• 
• 

Protein Description: chromosome 17 open reading frame 75
Gene Name: C17orf75
Alternative Gene Name: NJMU-R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057181: 84%, ENSRNOG00000000237: 83%
Entrez Gene ID: 64149
Uniprot ID: Q9HAS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI
• Gene Sequence: PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI
• Gene ID - Mouse: ENSMUSG00000057181
• Gene ID - Rat: ENSRNOG00000000237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C17orf75 pAb (ATL-HPA004061) – 1 Found

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.