Anti C17orf74 pAb (ATL-HPA023649)

Atlas Antibodies

SKU:
ATL-HPA023649-25
  • Immunohistochemical staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 74
Gene Name: C17orf74
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044084: 74%, ENSRNOG00000058939: 74%
Entrez Gene ID: 201243
Uniprot ID: Q0P670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPYPSVGWMLYDSWDQ
Gene Sequence LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPYPSVGWMLYDSWDQ
Gene ID - Mouse ENSMUSG00000044084
Gene ID - Rat ENSRNOG00000058939
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C17orf74 pAb (ATL-HPA023649)
Datasheet Anti C17orf74 pAb (ATL-HPA023649) Datasheet (External Link)
Vendor Page Anti C17orf74 pAb (ATL-HPA023649) at Atlas Antibodies

Documents & Links for Anti C17orf74 pAb (ATL-HPA023649)
Datasheet Anti C17orf74 pAb (ATL-HPA023649) Datasheet (External Link)
Vendor Page Anti C17orf74 pAb (ATL-HPA023649)