Anti C17orf74 pAb (ATL-HPA023649)

Atlas Antibodies

Catalog No.: ATL-HPA023649-25

Protein Description: chromosome 17 open reading frame 74
Gene Name: C17orf74
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044084: 74%, ENSRNOG00000058939: 74%
Entrez Gene ID: 201243
Uniprot ID: Q0P670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPYPSVGWMLYDSWDQ
• Gene Sequence: LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPYPSVGWMLYDSWDQ
• Gene ID - Mouse: ENSMUSG00000044084
• Gene ID - Rat: ENSRNOG00000058939
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.