Anti C17orf74 pAb (ATL-HPA023649)
Atlas Antibodies
- SKU:
- ATL-HPA023649-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C17orf74
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044084: 74%, ENSRNOG00000058939: 74%
Entrez Gene ID: 201243
Uniprot ID: Q0P670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPYPSVGWMLYDSWDQ |
Gene Sequence | LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPYPSVGWMLYDSWDQ |
Gene ID - Mouse | ENSMUSG00000044084 |
Gene ID - Rat | ENSRNOG00000058939 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C17orf74 pAb (ATL-HPA023649) | |
Datasheet | Anti C17orf74 pAb (ATL-HPA023649) Datasheet (External Link) |
Vendor Page | Anti C17orf74 pAb (ATL-HPA023649) at Atlas Antibodies |
Documents & Links for Anti C17orf74 pAb (ATL-HPA023649) | |
Datasheet | Anti C17orf74 pAb (ATL-HPA023649) Datasheet (External Link) |
Vendor Page | Anti C17orf74 pAb (ATL-HPA023649) |