Anti C17orf67 pAb (ATL-HPA043479)

Atlas Antibodies

Catalog No.:
ATL-HPA043479-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 67
Gene Name: C17orf67
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072553: 95%, ENSRNOG00000025121: 28%
Entrez Gene ID: 339210
Uniprot ID: Q0P5P2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TEKQAKQLLRSRRQDRPSKPGFPDEPMREYMHHLLALEHRAEEQFLEHWLNPHCKPHCDRNRIHPV
Gene Sequence TEKQAKQLLRSRRQDRPSKPGFPDEPMREYMHHLLALEHRAEEQFLEHWLNPHCKPHCDRNRIHPV
Gene ID - Mouse ENSMUSG00000072553
Gene ID - Rat ENSRNOG00000025121
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C17orf67 pAb (ATL-HPA043479)
Datasheet Anti C17orf67 pAb (ATL-HPA043479) Datasheet (External Link)
Vendor Page Anti C17orf67 pAb (ATL-HPA043479) at Atlas Antibodies

Documents & Links for Anti C17orf67 pAb (ATL-HPA043479)
Datasheet Anti C17orf67 pAb (ATL-HPA043479) Datasheet (External Link)
Vendor Page Anti C17orf67 pAb (ATL-HPA043479)