Anti C17orf64 pAb (ATL-HPA044415 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044415-25

• 
• 

Protein Description: chromosome 17 open reading frame 64
Gene Name: C17orf64
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018479: 60%, ENSRNOG00000003143: 62%
Entrez Gene ID: 124773
Uniprot ID: Q86WR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE
• Gene Sequence: LHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE
• Gene ID - Mouse: ENSMUSG00000018479
• Gene ID - Rat: ENSRNOG00000003143
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.