Anti C17orf58 pAb (ATL-HPA023036)

Atlas Antibodies

SKU:
ATL-HPA023036-25
  • Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 58
Gene Name: C17orf58
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078607: 89%, ENSRNOG00000043295: 86%
Entrez Gene ID: 284018
Uniprot ID: Q2M2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIH
Gene Sequence FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIH
Gene ID - Mouse ENSMUSG00000078607
Gene ID - Rat ENSRNOG00000043295
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C17orf58 pAb (ATL-HPA023036)
Datasheet Anti C17orf58 pAb (ATL-HPA023036) Datasheet (External Link)
Vendor Page Anti C17orf58 pAb (ATL-HPA023036) at Atlas Antibodies

Documents & Links for Anti C17orf58 pAb (ATL-HPA023036)
Datasheet Anti C17orf58 pAb (ATL-HPA023036) Datasheet (External Link)
Vendor Page Anti C17orf58 pAb (ATL-HPA023036)