Anti C17orf53 pAb (ATL-HPA024430)

Atlas Antibodies

SKU: ATL-HPA024430-25

• 

Protein Description: chromosome 17 open reading frame 53
Gene Name: C17orf53
Alternative Gene Name: MGC3130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034773: 81%, ENSRNOG00000020908: 84%
Entrez Gene ID: 78995
Uniprot ID: Q8N3J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNELKPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDVAAKPEEGFRTAQNLEAEASPEEELPEADDLDGLLSELPEDFFCGTS
• Gene Sequence: LTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNELKPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDVAAKPEEGFRTAQNLEAEASPEEELPEADDLDGLLSELPEDFFCGTS
• Gene ID - Mouse: ENSMUSG00000034773
• Gene ID - Rat: ENSRNOG00000020908
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.