Anti C17orf53 pAb (ATL-HPA023393)

Atlas Antibodies

SKU:
ATL-HPA023393-25
  • Immunohistochemical staining of human testis shows  strong granular cytoplasmic positivity in cells in seminiferous ducts.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 53
Gene Name: C17orf53
Alternative Gene Name: MGC3130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034773: 52%, ENSRNOG00000020908: 53%
Entrez Gene ID: 78995
Uniprot ID: Q8N3J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSEALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSS
Gene Sequence LFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSEALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSS
Gene ID - Mouse ENSMUSG00000034773
Gene ID - Rat ENSRNOG00000020908
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C17orf53 pAb (ATL-HPA023393)
Datasheet Anti C17orf53 pAb (ATL-HPA023393) Datasheet (External Link)
Vendor Page Anti C17orf53 pAb (ATL-HPA023393) at Atlas Antibodies

Documents & Links for Anti C17orf53 pAb (ATL-HPA023393)
Datasheet Anti C17orf53 pAb (ATL-HPA023393) Datasheet (External Link)
Vendor Page Anti C17orf53 pAb (ATL-HPA023393)



Citations for Anti C17orf53 pAb (ATL-HPA023393) – 2 Found
Wang, Chao; Chen, Zhen; Su, Dan; Tang, Mengfan; Nie, Litong; Zhang, Huimin; Feng, Xu; Wang, Rui; Shen, Xi; Srivastava, Mrinal; McLaughlin, Megan E; Hart, Traver; Li, Lei; Chen, Junjie. C17orf53 is identified as a novel gene involved in inter-strand crosslink repair. Dna Repair. 2020;95( 32853826):102946.  PubMed
Huang, Jen-Wei; Acharya, Ananya; Taglialatela, Angelo; Nambiar, Tarun S; Cuella-Martin, Raquel; Leuzzi, Giuseppe; Hayward, Samuel B; Joseph, Sarah A; Brunette, Gregory J; Anand, Roopesh; Soni, Rajesh K; Clark, Nathan L; Bernstein, Kara A; Cejka, Petr; Ciccia, Alberto. MCM8IP activates the MCM8-9 helicase to promote DNA synthesis and homologous recombination upon DNA damage. Nature Communications. 2020;11(1):2948.  PubMed