Anti C17orf53 pAb (ATL-HPA023393)
Atlas Antibodies
- SKU:
- ATL-HPA023393-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C17orf53
Alternative Gene Name: MGC3130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034773: 52%, ENSRNOG00000020908: 53%
Entrez Gene ID: 78995
Uniprot ID: Q8N3J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSEALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSS |
Gene Sequence | LFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSEALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSS |
Gene ID - Mouse | ENSMUSG00000034773 |
Gene ID - Rat | ENSRNOG00000020908 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C17orf53 pAb (ATL-HPA023393) | |
Datasheet | Anti C17orf53 pAb (ATL-HPA023393) Datasheet (External Link) |
Vendor Page | Anti C17orf53 pAb (ATL-HPA023393) at Atlas Antibodies |
Documents & Links for Anti C17orf53 pAb (ATL-HPA023393) | |
Datasheet | Anti C17orf53 pAb (ATL-HPA023393) Datasheet (External Link) |
Vendor Page | Anti C17orf53 pAb (ATL-HPA023393) |
Citations for Anti C17orf53 pAb (ATL-HPA023393) – 2 Found |
Wang, Chao; Chen, Zhen; Su, Dan; Tang, Mengfan; Nie, Litong; Zhang, Huimin; Feng, Xu; Wang, Rui; Shen, Xi; Srivastava, Mrinal; McLaughlin, Megan E; Hart, Traver; Li, Lei; Chen, Junjie. C17orf53 is identified as a novel gene involved in inter-strand crosslink repair. Dna Repair. 2020;95( 32853826):102946. PubMed |
Huang, Jen-Wei; Acharya, Ananya; Taglialatela, Angelo; Nambiar, Tarun S; Cuella-Martin, Raquel; Leuzzi, Giuseppe; Hayward, Samuel B; Joseph, Sarah A; Brunette, Gregory J; Anand, Roopesh; Soni, Rajesh K; Clark, Nathan L; Bernstein, Kara A; Cejka, Petr; Ciccia, Alberto. MCM8IP activates the MCM8-9 helicase to promote DNA synthesis and homologous recombination upon DNA damage. Nature Communications. 2020;11(1):2948. PubMed |