Anti C17orf49 pAb (ATL-HPA022961)

Atlas Antibodies

SKU:
ATL-HPA022961-25
  • Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 49
Gene Name: C17orf49
Alternative Gene Name: BAP18, HEPIS, MGC49942
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020831: 98%, ENSRNOG00000018829: 98%
Entrez Gene ID: 124944
Uniprot ID: Q8IXM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGI
Gene Sequence TSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGI
Gene ID - Mouse ENSMUSG00000020831
Gene ID - Rat ENSRNOG00000018829
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C17orf49 pAb (ATL-HPA022961)
Datasheet Anti C17orf49 pAb (ATL-HPA022961) Datasheet (External Link)
Vendor Page Anti C17orf49 pAb (ATL-HPA022961) at Atlas Antibodies

Documents & Links for Anti C17orf49 pAb (ATL-HPA022961)
Datasheet Anti C17orf49 pAb (ATL-HPA022961) Datasheet (External Link)
Vendor Page Anti C17orf49 pAb (ATL-HPA022961)