Anti C17orf47 pAb (ATL-HPA028424)

Atlas Antibodies

SKU:
ATL-HPA028424-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts along with additional cytoplasmic in Leydig cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 47
Gene Name: C17orf47
Alternative Gene Name: FLJ40121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090107: 40%, ENSRNOG00000057711: 28%
Entrez Gene ID: 284083
Uniprot ID: Q8NEP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSAYPETKPSAKVLVSSQVESNVRTPIRGNSEVGRRVTISPGVQSVEPTHHVTVPSVSEGSHKSSMFVTPEPIYKQQTQKPPEITYMSQGPTPRYPELSQKPSIHAEL
Gene Sequence YSAYPETKPSAKVLVSSQVESNVRTPIRGNSEVGRRVTISPGVQSVEPTHHVTVPSVSEGSHKSSMFVTPEPIYKQQTQKPPEITYMSQGPTPRYPELSQKPSIHAEL
Gene ID - Mouse ENSMUSG00000090107
Gene ID - Rat ENSRNOG00000057711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C17orf47 pAb (ATL-HPA028424)
Datasheet Anti C17orf47 pAb (ATL-HPA028424) Datasheet (External Link)
Vendor Page Anti C17orf47 pAb (ATL-HPA028424) at Atlas Antibodies

Documents & Links for Anti C17orf47 pAb (ATL-HPA028424)
Datasheet Anti C17orf47 pAb (ATL-HPA028424) Datasheet (External Link)
Vendor Page Anti C17orf47 pAb (ATL-HPA028424)