Anti C17orf105 pAb (ATL-HPA053028)

Atlas Antibodies

Catalog No.:
ATL-HPA053028-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 105
Gene Name: C17orf105
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010841: 85%, ENSRNOG00000036796: 85%
Entrez Gene ID: 284067
Uniprot ID: B2RV13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKKINKIEYENKQL
Gene Sequence MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKKINKIEYENKQL
Gene ID - Mouse ENSMUSG00000010841
Gene ID - Rat ENSRNOG00000036796
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C17orf105 pAb (ATL-HPA053028)
Datasheet Anti C17orf105 pAb (ATL-HPA053028) Datasheet (External Link)
Vendor Page Anti C17orf105 pAb (ATL-HPA053028) at Atlas Antibodies

Documents & Links for Anti C17orf105 pAb (ATL-HPA053028)
Datasheet Anti C17orf105 pAb (ATL-HPA053028) Datasheet (External Link)
Vendor Page Anti C17orf105 pAb (ATL-HPA053028)