Anti C17orf100 pAb (ATL-HPA046824)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046824-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C17orf100
Alternative Gene Name: LOC388327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025272: 33%, ENSRNOG00000014865: 60%
Entrez Gene ID: 388327
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QSSPRVGTTRYTETSTVRVETSSHRVETSSRRVETSQRRSEGPSLSPSGKRLPRILEASSRHVESSSQRTETTS |
| Gene Sequence | QSSPRVGTTRYTETSTVRVETSSHRVETSSRRVETSQRRSEGPSLSPSGKRLPRILEASSRHVESSSQRTETTS |
| Gene ID - Mouse | ENSMUSG00000025272 |
| Gene ID - Rat | ENSRNOG00000014865 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C17orf100 pAb (ATL-HPA046824) | |
| Datasheet | Anti C17orf100 pAb (ATL-HPA046824) Datasheet (External Link) |
| Vendor Page | Anti C17orf100 pAb (ATL-HPA046824) at Atlas Antibodies |
| Documents & Links for Anti C17orf100 pAb (ATL-HPA046824) | |
| Datasheet | Anti C17orf100 pAb (ATL-HPA046824) Datasheet (External Link) |
| Vendor Page | Anti C17orf100 pAb (ATL-HPA046824) |