Anti C16orf96 pAb (ATL-HPA042058)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042058-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C16orf96
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022518: 78%, ENSRNOG00000002014: 31%
Entrez Gene ID: 342346
Uniprot ID: A6NNT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMK |
| Gene Sequence | SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMK |
| Gene ID - Mouse | ENSMUSG00000022518 |
| Gene ID - Rat | ENSRNOG00000002014 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C16orf96 pAb (ATL-HPA042058) | |
| Datasheet | Anti C16orf96 pAb (ATL-HPA042058) Datasheet (External Link) |
| Vendor Page | Anti C16orf96 pAb (ATL-HPA042058) at Atlas Antibodies |
| Documents & Links for Anti C16orf96 pAb (ATL-HPA042058) | |
| Datasheet | Anti C16orf96 pAb (ATL-HPA042058) Datasheet (External Link) |
| Vendor Page | Anti C16orf96 pAb (ATL-HPA042058) |