Anti C16orf96 pAb (ATL-HPA042058)

Atlas Antibodies

Catalog No.:
ATL-HPA042058-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 96
Gene Name: C16orf96
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022518: 78%, ENSRNOG00000002014: 31%
Entrez Gene ID: 342346
Uniprot ID: A6NNT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMK
Gene Sequence SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMK
Gene ID - Mouse ENSMUSG00000022518
Gene ID - Rat ENSRNOG00000002014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C16orf96 pAb (ATL-HPA042058)
Datasheet Anti C16orf96 pAb (ATL-HPA042058) Datasheet (External Link)
Vendor Page Anti C16orf96 pAb (ATL-HPA042058) at Atlas Antibodies

Documents & Links for Anti C16orf96 pAb (ATL-HPA042058)
Datasheet Anti C16orf96 pAb (ATL-HPA042058) Datasheet (External Link)
Vendor Page Anti C16orf96 pAb (ATL-HPA042058)