Anti C16orf96 pAb (ATL-HPA042058)

Atlas Antibodies

Catalog No.: ATL-HPA042058-25

Protein Description: chromosome 16 open reading frame 96
Gene Name: C16orf96
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022518: 78%, ENSRNOG00000002014: 31%
Entrez Gene ID: 342346
Uniprot ID: A6NNT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMK
• Gene Sequence: SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMK
• Gene ID - Mouse: ENSMUSG00000022518
• Gene ID - Rat: ENSRNOG00000002014
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.