Anti C16orf95 pAb (ATL-HPA040850)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040850-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C16orf95
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031809: 40%, ENSRNOG00000050028: 38%
Entrez Gene ID: 100506581
Uniprot ID: Q9H693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS |
| Gene Sequence | WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS |
| Gene ID - Mouse | ENSMUSG00000031809 |
| Gene ID - Rat | ENSRNOG00000050028 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C16orf95 pAb (ATL-HPA040850) | |
| Datasheet | Anti C16orf95 pAb (ATL-HPA040850) Datasheet (External Link) |
| Vendor Page | Anti C16orf95 pAb (ATL-HPA040850) at Atlas Antibodies |
| Documents & Links for Anti C16orf95 pAb (ATL-HPA040850) | |
| Datasheet | Anti C16orf95 pAb (ATL-HPA040850) Datasheet (External Link) |
| Vendor Page | Anti C16orf95 pAb (ATL-HPA040850) |