Anti C16orf95 pAb (ATL-HPA040850)

Atlas Antibodies

Catalog No.:
ATL-HPA040850-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 95
Gene Name: C16orf95
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031809: 40%, ENSRNOG00000050028: 38%
Entrez Gene ID: 100506581
Uniprot ID: Q9H693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS
Gene Sequence WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS
Gene ID - Mouse ENSMUSG00000031809
Gene ID - Rat ENSRNOG00000050028
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C16orf95 pAb (ATL-HPA040850)
Datasheet Anti C16orf95 pAb (ATL-HPA040850) Datasheet (External Link)
Vendor Page Anti C16orf95 pAb (ATL-HPA040850) at Atlas Antibodies

Documents & Links for Anti C16orf95 pAb (ATL-HPA040850)
Datasheet Anti C16orf95 pAb (ATL-HPA040850) Datasheet (External Link)
Vendor Page Anti C16orf95 pAb (ATL-HPA040850)