Anti C16orf95 pAb (ATL-HPA040850)
Atlas Antibodies
- SKU:
- ATL-HPA040850-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C16orf95
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031809: 40%, ENSRNOG00000050028: 38%
Entrez Gene ID: 100506581
Uniprot ID: Q9H693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS |
Gene Sequence | WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS |
Gene ID - Mouse | ENSMUSG00000031809 |
Gene ID - Rat | ENSRNOG00000050028 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C16orf95 pAb (ATL-HPA040850) | |
Datasheet | Anti C16orf95 pAb (ATL-HPA040850) Datasheet (External Link) |
Vendor Page | Anti C16orf95 pAb (ATL-HPA040850) at Atlas Antibodies |
Documents & Links for Anti C16orf95 pAb (ATL-HPA040850) | |
Datasheet | Anti C16orf95 pAb (ATL-HPA040850) Datasheet (External Link) |
Vendor Page | Anti C16orf95 pAb (ATL-HPA040850) |