Anti C16orf89 pAb (ATL-HPA013613 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA013613-25

Protein Description: chromosome 16 open reading frame 89
Gene Name: C16orf89
Alternative Gene Name: MGC45438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051669: 70%, ENSRNOG00000021796: 73%
Entrez Gene ID: 146556
Uniprot ID: Q6UX73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA
• Gene Sequence: KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA
• Gene ID - Mouse: ENSMUSG00000051669
• Gene ID - Rat: ENSRNOG00000021796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.