Anti C16orf89 pAb (ATL-HPA013613 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA013613-25
  • Immunohistochemical staining of human colon, kidney, testis and thyroid gland using Anti-C16orf89 antibody HPA013613 (A) shows similar protein distribution across tissues to independent antibody HPA016934 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 89
Gene Name: C16orf89
Alternative Gene Name: MGC45438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051669: 70%, ENSRNOG00000021796: 73%
Entrez Gene ID: 146556
Uniprot ID: Q6UX73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA
Gene Sequence KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA
Gene ID - Mouse ENSMUSG00000051669
Gene ID - Rat ENSRNOG00000021796
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C16orf89 pAb (ATL-HPA013613 w/enhanced validation)
Datasheet Anti C16orf89 pAb (ATL-HPA013613 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C16orf89 pAb (ATL-HPA013613 w/enhanced validation)