Anti C16orf74 pAb (ATL-HPA049367)

Atlas Antibodies

Catalog No.:
ATL-HPA049367-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 74
Gene Name: C16orf74
Alternative Gene Name: MGC17624
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097919: 71%, ENSRNOG00000017646: 71%
Entrez Gene ID: 404550
Uniprot ID: Q96GX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDP
Gene Sequence PVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDP
Gene ID - Mouse ENSMUSG00000097919
Gene ID - Rat ENSRNOG00000017646
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C16orf74 pAb (ATL-HPA049367)
Datasheet Anti C16orf74 pAb (ATL-HPA049367) Datasheet (External Link)
Vendor Page Anti C16orf74 pAb (ATL-HPA049367) at Atlas Antibodies

Documents & Links for Anti C16orf74 pAb (ATL-HPA049367)
Datasheet Anti C16orf74 pAb (ATL-HPA049367) Datasheet (External Link)
Vendor Page Anti C16orf74 pAb (ATL-HPA049367)