Anti C16orf74 pAb (ATL-HPA049367)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049367-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C16orf74
Alternative Gene Name: MGC17624
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097919: 71%, ENSRNOG00000017646: 71%
Entrez Gene ID: 404550
Uniprot ID: Q96GX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDP |
Gene Sequence | PVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDP |
Gene ID - Mouse | ENSMUSG00000097919 |
Gene ID - Rat | ENSRNOG00000017646 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C16orf74 pAb (ATL-HPA049367) | |
Datasheet | Anti C16orf74 pAb (ATL-HPA049367) Datasheet (External Link) |
Vendor Page | Anti C16orf74 pAb (ATL-HPA049367) at Atlas Antibodies |
Documents & Links for Anti C16orf74 pAb (ATL-HPA049367) | |
Datasheet | Anti C16orf74 pAb (ATL-HPA049367) Datasheet (External Link) |
Vendor Page | Anti C16orf74 pAb (ATL-HPA049367) |