Anti C16orf72 pAb (ATL-HPA041568)

Atlas Antibodies

Catalog No.:
ATL-HPA041568-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 72
Gene Name: C16orf72
Alternative Gene Name: FLJ41272, PRO0149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022507: 100%, ENSRNOG00000002545: 100%
Entrez Gene ID: 29035
Uniprot ID: Q14CZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLWHLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLC
Gene Sequence KLWHLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLC
Gene ID - Mouse ENSMUSG00000022507
Gene ID - Rat ENSRNOG00000002545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C16orf72 pAb (ATL-HPA041568)
Datasheet Anti C16orf72 pAb (ATL-HPA041568) Datasheet (External Link)
Vendor Page Anti C16orf72 pAb (ATL-HPA041568) at Atlas Antibodies

Documents & Links for Anti C16orf72 pAb (ATL-HPA041568)
Datasheet Anti C16orf72 pAb (ATL-HPA041568) Datasheet (External Link)
Vendor Page Anti C16orf72 pAb (ATL-HPA041568)