Anti C16orf72 pAb (ATL-HPA041568)
Atlas Antibodies
- SKU:
- ATL-HPA041568-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: C16orf72
Alternative Gene Name: FLJ41272, PRO0149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022507: 100%, ENSRNOG00000002545: 100%
Entrez Gene ID: 29035
Uniprot ID: Q14CZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLWHLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLC |
Gene Sequence | KLWHLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLC |
Gene ID - Mouse | ENSMUSG00000022507 |
Gene ID - Rat | ENSRNOG00000002545 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C16orf72 pAb (ATL-HPA041568) | |
Datasheet | Anti C16orf72 pAb (ATL-HPA041568) Datasheet (External Link) |
Vendor Page | Anti C16orf72 pAb (ATL-HPA041568) at Atlas Antibodies |
Documents & Links for Anti C16orf72 pAb (ATL-HPA041568) | |
Datasheet | Anti C16orf72 pAb (ATL-HPA041568) Datasheet (External Link) |
Vendor Page | Anti C16orf72 pAb (ATL-HPA041568) |