Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049468-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C16orf71
Alternative Gene Name: DKFZp686H2240, FLJ43261
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042010: 29%, ENSRNOG00000028075: 63%
Entrez Gene ID: 146562
Uniprot ID: Q8IYS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MASNDKGMAPSLGSPWASQMGPWDAILKAVKDQLPSLDSDSPLSDYGEEELFIFQRNQTSLIPDLSEELAEDPADG |
| Gene Sequence | MASNDKGMAPSLGSPWASQMGPWDAILKAVKDQLPSLDSDSPLSDYGEEELFIFQRNQTSLIPDLSEELAEDPADG |
| Gene ID - Mouse | ENSMUSG00000042010 |
| Gene ID - Rat | ENSRNOG00000028075 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) | |
| Datasheet | Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) | |
| Datasheet | Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) |
| Citations for Anti C16orf71 pAb (ATL-HPA049468 w/enhanced validation) – 2 Found |
| Lee, Chanjae; Cox, Rachael M; Papoulas, Ophelia; Horani, Amjad; Drew, Kevin; Devitt, Caitlin C; Brody, Steven L; Marcotte, Edward M; Wallingford, John B. Functional partitioning of a liquid-like organelle during assembly of axonemal dyneins. Elife. 2020;9( 33263282) PubMed |
| Mateos-Quiros, Clara Maria; Garrido-Jimenez, Sergio; Álvarez-Hernán, Guadalupe; Diaz-Chamorro, Selene; Barrera-Lopez, Juan Francisco; Francisco-Morcillo, Javier; Roman, Angel Carlos; Centeno, Francisco; Carvajal-Gonzalez, Jose Maria. Junctional Adhesion Molecule 3 Expression in the Mouse Airway Epithelium Is Linked to Multiciliated Cells. Frontiers In Cell And Developmental Biology. 9( 34395412):622515. PubMed |