Anti C16orf70 pAb (ATL-HPA041214)

Atlas Antibodies

Catalog No.:
ATL-HPA041214-25
Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles & cytosol.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 70
Gene Name: C16orf70
Alternative Gene Name: C16orf6, FLJ12076, lin-10, LIN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031889: 96%, ENSRNOG00000014668: 98%
Entrez Gene ID: 80262
Uniprot ID: Q9BSU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKL
Gene Sequence MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKL
Gene ID - Mouse ENSMUSG00000031889
Gene ID - Rat ENSRNOG00000014668
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C16orf70 pAb (ATL-HPA041214)
Datasheet Anti C16orf70 pAb (ATL-HPA041214) Datasheet (External Link)
Vendor Page Anti C16orf70 pAb (ATL-HPA041214) at Atlas Antibodies

Documents & Links for Anti C16orf70 pAb (ATL-HPA041214)
Datasheet Anti C16orf70 pAb (ATL-HPA041214) Datasheet (External Link)
Vendor Page Anti C16orf70 pAb (ATL-HPA041214)
!