Anti C16orf70 pAb (ATL-HPA041131 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041131-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C16orf70 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403058).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 70
Gene Name: C16orf70
Alternative Gene Name: C16orf6, FLJ12076, lin-10, LIN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031889: 96%, ENSRNOG00000014668: 97%
Entrez Gene ID: 80262
Uniprot ID: Q9BSU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKS
Gene Sequence HGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKS
Gene ID - Mouse ENSMUSG00000031889
Gene ID - Rat ENSRNOG00000014668
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C16orf70 pAb (ATL-HPA041131 w/enhanced validation)
Datasheet Anti C16orf70 pAb (ATL-HPA041131 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C16orf70 pAb (ATL-HPA041131 w/enhanced validation)