Anti C16orf62 pAb (ATL-HPA042969)

Atlas Antibodies

Catalog No.:
ATL-HPA042969-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 62
Gene Name: C16orf62
Alternative Gene Name: MGC16824
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030982: 93%, ENSRNOG00000016063: 91%
Entrez Gene ID: 57020
Uniprot ID: Q7Z3J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENNKLCETVMAQILEHLKTLAKDEALKRQSSLGLSFFNSILAHGDLRNNKLNQLSVNLWHLAQRHGCADTRTMVKTLEYIKKQSKQPDMTHLTELA
Gene Sequence ENNKLCETVMAQILEHLKTLAKDEALKRQSSLGLSFFNSILAHGDLRNNKLNQLSVNLWHLAQRHGCADTRTMVKTLEYIKKQSKQPDMTHLTELA
Gene ID - Mouse ENSMUSG00000030982
Gene ID - Rat ENSRNOG00000016063
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C16orf62 pAb (ATL-HPA042969)
Datasheet Anti C16orf62 pAb (ATL-HPA042969) Datasheet (External Link)
Vendor Page Anti C16orf62 pAb (ATL-HPA042969) at Atlas Antibodies

Documents & Links for Anti C16orf62 pAb (ATL-HPA042969)
Datasheet Anti C16orf62 pAb (ATL-HPA042969) Datasheet (External Link)
Vendor Page Anti C16orf62 pAb (ATL-HPA042969)
Citations for Anti C16orf62 pAb (ATL-HPA042969) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed