Anti C16orf59 pAb (ATL-HPA055389)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055389-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C16orf59
Alternative Gene Name: FLJ13909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024118: 45%, ENSRNOG00000007436: 54%
Entrez Gene ID: 80178
Uniprot ID: Q7L2K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAKGHPERRLLSVGDGTRVGM |
Gene Sequence | EKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAKGHPERRLLSVGDGTRVGM |
Gene ID - Mouse | ENSMUSG00000024118 |
Gene ID - Rat | ENSRNOG00000007436 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C16orf59 pAb (ATL-HPA055389) | |
Datasheet | Anti C16orf59 pAb (ATL-HPA055389) Datasheet (External Link) |
Vendor Page | Anti C16orf59 pAb (ATL-HPA055389) at Atlas Antibodies |
Documents & Links for Anti C16orf59 pAb (ATL-HPA055389) | |
Datasheet | Anti C16orf59 pAb (ATL-HPA055389) Datasheet (External Link) |
Vendor Page | Anti C16orf59 pAb (ATL-HPA055389) |