Anti C16orf46 pAb (ATL-HPA041379)

Atlas Antibodies

SKU: ATL-HPA041379-25

• 
• 

Protein Description: chromosome 16 open reading frame 46
Gene Name: C16orf46
Alternative Gene Name: FLJ32702
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031847: 60%, ENSRNOG00000045541: 49%
Entrez Gene ID: 123775
Uniprot ID: Q6P387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALDVLGKKSKNSFLQSEEKVLDVEKDGCVAYAYGLKTADGKGEKRASELAKHPMVNDTPSSPSPAAQISLLT
• Gene Sequence: ALDVLGKKSKNSFLQSEEKVLDVEKDGCVAYAYGLKTADGKGEKRASELAKHPMVNDTPSSPSPAAQISLLT
• Gene ID - Mouse: ENSMUSG00000031847
• Gene ID - Rat: ENSRNOG00000045541
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.