Anti C16orf46 pAb (ATL-HPA041379)

Atlas Antibodies

Catalog No.:
ATL-HPA041379-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 46
Gene Name: C16orf46
Alternative Gene Name: FLJ32702
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031847: 60%, ENSRNOG00000045541: 49%
Entrez Gene ID: 123775
Uniprot ID: Q6P387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALDVLGKKSKNSFLQSEEKVLDVEKDGCVAYAYGLKTADGKGEKRASELAKHPMVNDTPSSPSPAAQISLLT
Gene Sequence ALDVLGKKSKNSFLQSEEKVLDVEKDGCVAYAYGLKTADGKGEKRASELAKHPMVNDTPSSPSPAAQISLLT
Gene ID - Mouse ENSMUSG00000031847
Gene ID - Rat ENSRNOG00000045541
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C16orf46 pAb (ATL-HPA041379)
Datasheet Anti C16orf46 pAb (ATL-HPA041379) Datasheet (External Link)
Vendor Page Anti C16orf46 pAb (ATL-HPA041379) at Atlas Antibodies

Documents & Links for Anti C16orf46 pAb (ATL-HPA041379)
Datasheet Anti C16orf46 pAb (ATL-HPA041379) Datasheet (External Link)
Vendor Page Anti C16orf46 pAb (ATL-HPA041379)