Anti C16orf45 pAb (ATL-HPA041114 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041114-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in renal tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C16orf45 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409626).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 16 open reading frame 45
Gene Name: C16orf45
Alternative Gene Name: FLJ32618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044117: 93%, ENSRNOG00000003198: 92%
Entrez Gene ID: 89927
Uniprot ID: Q96MC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRRESELRFMMDDIQLCKDIMDLKQEL
Gene Sequence SLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRRESELRFMMDDIQLCKDIMDLKQEL
Gene ID - Mouse ENSMUSG00000044117
Gene ID - Rat ENSRNOG00000003198
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C16orf45 pAb (ATL-HPA041114 w/enhanced validation)
Datasheet Anti C16orf45 pAb (ATL-HPA041114 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C16orf45 pAb (ATL-HPA041114 w/enhanced validation)