Anti C15orf65 pAb (ATL-HPA067189)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067189-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C15orf65
Alternative Gene Name: FLJ27352
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086158: 61%, ENSRNOG00000052869: 65%
Entrez Gene ID: 145788
Uniprot ID: H3BRN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPN |
Gene Sequence | SSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPN |
Gene ID - Mouse | ENSMUSG00000086158 |
Gene ID - Rat | ENSRNOG00000052869 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C15orf65 pAb (ATL-HPA067189) | |
Datasheet | Anti C15orf65 pAb (ATL-HPA067189) Datasheet (External Link) |
Vendor Page | Anti C15orf65 pAb (ATL-HPA067189) at Atlas Antibodies |
Documents & Links for Anti C15orf65 pAb (ATL-HPA067189) | |
Datasheet | Anti C15orf65 pAb (ATL-HPA067189) Datasheet (External Link) |
Vendor Page | Anti C15orf65 pAb (ATL-HPA067189) |