Anti C15orf65 pAb (ATL-HPA067189)

Atlas Antibodies

SKU: ATL-HPA067189-25

• 
• 

Protein Description: chromosome 15 open reading frame 65
Gene Name: C15orf65
Alternative Gene Name: FLJ27352
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086158: 61%, ENSRNOG00000052869: 65%
Entrez Gene ID: 145788
Uniprot ID: H3BRN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPN
• Gene Sequence: SSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPN
• Gene ID - Mouse: ENSMUSG00000086158
• Gene ID - Rat: ENSRNOG00000052869
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.