Anti C15orf62 pAb (ATL-HPA044636)

Atlas Antibodies

Catalog No.:
ATL-HPA044636-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 15 open reading frame 62
Gene Name: C15orf62
Alternative Gene Name: LOC643338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055926: 79%, ENSRNOG00000025980: 79%
Entrez Gene ID: 643338
Uniprot ID: A8K5M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF
Gene Sequence SLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF
Gene ID - Mouse ENSMUSG00000055926
Gene ID - Rat ENSRNOG00000025980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C15orf62 pAb (ATL-HPA044636)
Datasheet Anti C15orf62 pAb (ATL-HPA044636) Datasheet (External Link)
Vendor Page Anti C15orf62 pAb (ATL-HPA044636) at Atlas Antibodies

Documents & Links for Anti C15orf62 pAb (ATL-HPA044636)
Datasheet Anti C15orf62 pAb (ATL-HPA044636) Datasheet (External Link)
Vendor Page Anti C15orf62 pAb (ATL-HPA044636)