Anti C15orf62 pAb (ATL-HPA044636)

Atlas Antibodies

Catalog No.: ATL-HPA044636-25

Protein Description: chromosome 15 open reading frame 62
Gene Name: C15orf62
Alternative Gene Name: LOC643338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055926: 79%, ENSRNOG00000025980: 79%
Entrez Gene ID: 643338
Uniprot ID: A8K5M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF
• Gene Sequence: SLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF
• Gene ID - Mouse: ENSMUSG00000055926
• Gene ID - Rat: ENSRNOG00000025980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.