Anti C15orf62 pAb (ATL-HPA044636)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044636-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C15orf62
Alternative Gene Name: LOC643338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055926: 79%, ENSRNOG00000025980: 79%
Entrez Gene ID: 643338
Uniprot ID: A8K5M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF |
| Gene Sequence | SLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF |
| Gene ID - Mouse | ENSMUSG00000055926 |
| Gene ID - Rat | ENSRNOG00000025980 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C15orf62 pAb (ATL-HPA044636) | |
| Datasheet | Anti C15orf62 pAb (ATL-HPA044636) Datasheet (External Link) |
| Vendor Page | Anti C15orf62 pAb (ATL-HPA044636) at Atlas Antibodies |
| Documents & Links for Anti C15orf62 pAb (ATL-HPA044636) | |
| Datasheet | Anti C15orf62 pAb (ATL-HPA044636) Datasheet (External Link) |
| Vendor Page | Anti C15orf62 pAb (ATL-HPA044636) |