Anti C15orf61 pAb (ATL-HPA062820)

Atlas Antibodies

SKU: ATL-HPA062820-25

• 

Protein Description: chromosome 15 open reading frame 61
Gene Name: C15orf61
Alternative Gene Name: LOC145853
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032403: 91%, ENSRNOG00000008340: 91%
Entrez Gene ID: 145853
Uniprot ID: A6NNL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQ
• Gene Sequence: KPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQ
• Gene ID - Mouse: ENSMUSG00000032403
• Gene ID - Rat: ENSRNOG00000008340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.