Anti C15orf59 pAb (ATL-HPA041563)

Atlas Antibodies

Catalog No.:
ATL-HPA041563-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 15 open reading frame 59
Gene Name: C15orf59
Alternative Gene Name: LOC388135, MGC131524
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066607: 77%, ENSRNOG00000026238: 80%
Entrez Gene ID: 388135
Uniprot ID: Q2T9L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEEEEVGLPPEPAHTEAHAGPHKPSPAPYKSRRSPLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTA
Gene Sequence VEEEEVGLPPEPAHTEAHAGPHKPSPAPYKSRRSPLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTA
Gene ID - Mouse ENSMUSG00000066607
Gene ID - Rat ENSRNOG00000026238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C15orf59 pAb (ATL-HPA041563)
Datasheet Anti C15orf59 pAb (ATL-HPA041563) Datasheet (External Link)
Vendor Page Anti C15orf59 pAb (ATL-HPA041563) at Atlas Antibodies

Documents & Links for Anti C15orf59 pAb (ATL-HPA041563)
Datasheet Anti C15orf59 pAb (ATL-HPA041563) Datasheet (External Link)
Vendor Page Anti C15orf59 pAb (ATL-HPA041563)