Anti C15orf59 pAb (ATL-HPA041563)

Atlas Antibodies

Catalog No.: ATL-HPA041563-25

Protein Description: chromosome 15 open reading frame 59
Gene Name: C15orf59
Alternative Gene Name: LOC388135, MGC131524
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066607: 77%, ENSRNOG00000026238: 80%
Entrez Gene ID: 388135
Uniprot ID: Q2T9L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEEEEVGLPPEPAHTEAHAGPHKPSPAPYKSRRSPLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTA
• Gene Sequence: VEEEEVGLPPEPAHTEAHAGPHKPSPAPYKSRRSPLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTA
• Gene ID - Mouse: ENSMUSG00000066607
• Gene ID - Rat: ENSRNOG00000026238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.