Anti C15orf57 pAb (ATL-HPA041688)

Atlas Antibodies

Catalog No.:
ATL-HPA041688-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 15 open reading frame 57
Gene Name: C15orf57
Alternative Gene Name: CCDC32, MGC20481
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039983: 71%, ENSRNOG00000010472: 74%
Entrez Gene ID: 90416
Uniprot ID: Q9BV29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSGLRFQMKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKL
Gene Sequence GSGLRFQMKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKL
Gene ID - Mouse ENSMUSG00000039983
Gene ID - Rat ENSRNOG00000010472
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C15orf57 pAb (ATL-HPA041688)
Datasheet Anti C15orf57 pAb (ATL-HPA041688) Datasheet (External Link)
Vendor Page Anti C15orf57 pAb (ATL-HPA041688) at Atlas Antibodies

Documents & Links for Anti C15orf57 pAb (ATL-HPA041688)
Datasheet Anti C15orf57 pAb (ATL-HPA041688) Datasheet (External Link)
Vendor Page Anti C15orf57 pAb (ATL-HPA041688)