Anti C15orf53 pAb (ATL-HPA041914)

Atlas Antibodies

SKU:
ATL-HPA041914-25
  • Immunohistochemical staining of human esophagus shows moderate cytoplasmic, membranous and nuclear positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 15 open reading frame 53
Gene Name: C15orf53
Alternative Gene Name: FLJ35695
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040433: 27%, ENSRNOG00000053562: 28%
Entrez Gene ID: 400359
Uniprot ID: Q8NAA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLGEDASLLFSKSPFGAGKL
Gene Sequence QEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLGEDASLLFSKSPFGAGKL
Gene ID - Mouse ENSMUSG00000040433
Gene ID - Rat ENSRNOG00000053562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C15orf53 pAb (ATL-HPA041914)
Datasheet Anti C15orf53 pAb (ATL-HPA041914) Datasheet (External Link)
Vendor Page Anti C15orf53 pAb (ATL-HPA041914) at Atlas Antibodies

Documents & Links for Anti C15orf53 pAb (ATL-HPA041914)
Datasheet Anti C15orf53 pAb (ATL-HPA041914) Datasheet (External Link)
Vendor Page Anti C15orf53 pAb (ATL-HPA041914)