Anti C15orf52 pAb (ATL-HPA041834)

Atlas Antibodies

Catalog No.: ATL-HPA041834-25

Protein Description: chromosome 15 open reading frame 52
Gene Name: C15orf52
Alternative Gene Name: FLJ43339
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045838: 73%, ENSRNOG00000028910: 70%
Entrez Gene ID: 388115
Uniprot ID: Q6ZUT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALLQPDGLTVTISQVPGEKRVVSRNWARGTCGPRVTNEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSEK
• Gene Sequence: ALLQPDGLTVTISQVPGEKRVVSRNWARGTCGPRVTNEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSEK
• Gene ID - Mouse: ENSMUSG00000045838
• Gene ID - Rat: ENSRNOG00000028910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.