Anti C15orf52 pAb (ATL-HPA041834)

Atlas Antibodies

SKU:
ATL-HPA041834-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 15 open reading frame 52
Gene Name: C15orf52
Alternative Gene Name: FLJ43339
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045838: 73%, ENSRNOG00000028910: 70%
Entrez Gene ID: 388115
Uniprot ID: Q6ZUT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALLQPDGLTVTISQVPGEKRVVSRNWARGTCGPRVTNEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSEK
Gene Sequence ALLQPDGLTVTISQVPGEKRVVSRNWARGTCGPRVTNEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSEK
Gene ID - Mouse ENSMUSG00000045838
Gene ID - Rat ENSRNOG00000028910
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C15orf52 pAb (ATL-HPA041834)
Datasheet Anti C15orf52 pAb (ATL-HPA041834) Datasheet (External Link)
Vendor Page Anti C15orf52 pAb (ATL-HPA041834) at Atlas Antibodies

Documents & Links for Anti C15orf52 pAb (ATL-HPA041834)
Datasheet Anti C15orf52 pAb (ATL-HPA041834) Datasheet (External Link)
Vendor Page Anti C15orf52 pAb (ATL-HPA041834)