Anti C15orf41 pAb (ATL-HPA061023)

Atlas Antibodies

Catalog No.:
ATL-HPA061023-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 15 open reading frame 41
Gene Name: C15orf41
Alternative Gene Name: FLJ22851, HH114, MGC11326
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040282: 95%, ENSRNOG00000004571: 94%
Entrez Gene ID: 84529
Uniprot ID: Q9Y2V0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESYYQRYLNGVVKNGAAPVLLDLA
Gene Sequence TKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESYYQRYLNGVVKNGAAPVLLDLA
Gene ID - Mouse ENSMUSG00000040282
Gene ID - Rat ENSRNOG00000004571
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C15orf41 pAb (ATL-HPA061023)
Datasheet Anti C15orf41 pAb (ATL-HPA061023) Datasheet (External Link)
Vendor Page Anti C15orf41 pAb (ATL-HPA061023) at Atlas Antibodies

Documents & Links for Anti C15orf41 pAb (ATL-HPA061023)
Datasheet Anti C15orf41 pAb (ATL-HPA061023) Datasheet (External Link)
Vendor Page Anti C15orf41 pAb (ATL-HPA061023)
Citations for Anti C15orf41 pAb (ATL-HPA061023) – 1 Found
Russo, Roberta; Marra, Roberta; Andolfo, Immacolata; De Rosa, Gianluca; Rosato, Barbara Eleni; Manna, Francesco; Gambale, Antonella; Raia, Maddalena; Unal, Sule; Barella, Susanna; Iolascon, Achille. Characterization of Two Cases of Congenital Dyserythropoietic Anemia Type I Shed Light on the Uncharacterized C15orf41 Protein. Frontiers In Physiology. 10( 31191338):621.  PubMed