Anti C15orf39 pAb (ATL-HPA041907)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041907-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C15orf39
Alternative Gene Name: DKFZP434H132, FLJ46337
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032300: 80%, ENSRNOG00000018689: 78%
Entrez Gene ID: 56905
Uniprot ID: Q6ZRI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TPRCPLDFAPQTLSFPYARDDLSLYGASPGLGGTPPSQNNVRAVPQPGAFQRACQPLPASQPCSEPVRPAQEAEEKTWLPSCRKEKLQPRLSEHSG |
| Gene Sequence | TPRCPLDFAPQTLSFPYARDDLSLYGASPGLGGTPPSQNNVRAVPQPGAFQRACQPLPASQPCSEPVRPAQEAEEKTWLPSCRKEKLQPRLSEHSG |
| Gene ID - Mouse | ENSMUSG00000032300 |
| Gene ID - Rat | ENSRNOG00000018689 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C15orf39 pAb (ATL-HPA041907) | |
| Datasheet | Anti C15orf39 pAb (ATL-HPA041907) Datasheet (External Link) |
| Vendor Page | Anti C15orf39 pAb (ATL-HPA041907) at Atlas Antibodies |
| Documents & Links for Anti C15orf39 pAb (ATL-HPA041907) | |
| Datasheet | Anti C15orf39 pAb (ATL-HPA041907) Datasheet (External Link) |
| Vendor Page | Anti C15orf39 pAb (ATL-HPA041907) |