Anti C15orf39 pAb (ATL-HPA039961)

Atlas Antibodies

Catalog No.: ATL-HPA039961-25

Protein Description: chromosome 15 open reading frame 39
Gene Name: C15orf39
Alternative Gene Name: DKFZP434H132, FLJ46337
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032300: 92%, ENSRNOG00000018689: 88%
Entrez Gene ID: 56905
Uniprot ID: Q6ZRI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCDAISGSVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAGAIFVPIHLVKERLFPRLPPASVDHVL
• Gene Sequence: LCDAISGSVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAGAIFVPIHLVKERLFPRLPPASVDHVL
• Gene ID - Mouse: ENSMUSG00000032300
• Gene ID - Rat: ENSRNOG00000018689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.