Anti C15orf39 pAb (ATL-HPA039961)

Atlas Antibodies

Catalog No.:
ATL-HPA039961-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 15 open reading frame 39
Gene Name: C15orf39
Alternative Gene Name: DKFZP434H132, FLJ46337
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032300: 92%, ENSRNOG00000018689: 88%
Entrez Gene ID: 56905
Uniprot ID: Q6ZRI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCDAISGSVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAGAIFVPIHLVKERLFPRLPPASVDHVL
Gene Sequence LCDAISGSVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAGAIFVPIHLVKERLFPRLPPASVDHVL
Gene ID - Mouse ENSMUSG00000032300
Gene ID - Rat ENSRNOG00000018689
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C15orf39 pAb (ATL-HPA039961)
Datasheet Anti C15orf39 pAb (ATL-HPA039961) Datasheet (External Link)
Vendor Page Anti C15orf39 pAb (ATL-HPA039961) at Atlas Antibodies

Documents & Links for Anti C15orf39 pAb (ATL-HPA039961)
Datasheet Anti C15orf39 pAb (ATL-HPA039961) Datasheet (External Link)
Vendor Page Anti C15orf39 pAb (ATL-HPA039961)