Anti C14orf80 pAb (ATL-HPA039049)

Atlas Antibodies

Catalog No.: ATL-HPA039049-25

Protein Description: chromosome 14 open reading frame 80
Gene Name: C14orf80
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037466: 67%, ENSRNOG00000005153: 65%
Entrez Gene ID: 283643
Uniprot ID: Q86SX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVLSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTV
• Gene Sequence: RVLSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTV
• Gene ID - Mouse: ENSMUSG00000037466
• Gene ID - Rat: ENSRNOG00000005153
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.