Anti C14orf80 pAb (ATL-HPA039049)

Atlas Antibodies

Catalog No.:
ATL-HPA039049-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 14 open reading frame 80
Gene Name: C14orf80
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037466: 67%, ENSRNOG00000005153: 65%
Entrez Gene ID: 283643
Uniprot ID: Q86SX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVLSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTV
Gene Sequence RVLSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTV
Gene ID - Mouse ENSMUSG00000037466
Gene ID - Rat ENSRNOG00000005153
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C14orf80 pAb (ATL-HPA039049)
Datasheet Anti C14orf80 pAb (ATL-HPA039049) Datasheet (External Link)
Vendor Page Anti C14orf80 pAb (ATL-HPA039049) at Atlas Antibodies

Documents & Links for Anti C14orf80 pAb (ATL-HPA039049)
Datasheet Anti C14orf80 pAb (ATL-HPA039049) Datasheet (External Link)
Vendor Page Anti C14orf80 pAb (ATL-HPA039049)