Anti C14orf79 pAb (ATL-HPA042052)

Atlas Antibodies

SKU:
ATL-HPA042052-25
  • Immunohistochemical staining of human pancreas shows moderate membranous positivity in exocrine cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies, plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 14 open reading frame 79
Gene Name: C14orf79
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037594: 60%, ENSRNOG00000013690: 61%
Entrez Gene ID: 122616
Uniprot ID: Q96F83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGPWVTGTSAVPPSEPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKL
Gene Sequence GGPWVTGTSAVPPSEPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKL
Gene ID - Mouse ENSMUSG00000037594
Gene ID - Rat ENSRNOG00000013690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C14orf79 pAb (ATL-HPA042052)
Datasheet Anti C14orf79 pAb (ATL-HPA042052) Datasheet (External Link)
Vendor Page Anti C14orf79 pAb (ATL-HPA042052) at Atlas Antibodies

Documents & Links for Anti C14orf79 pAb (ATL-HPA042052)
Datasheet Anti C14orf79 pAb (ATL-HPA042052) Datasheet (External Link)
Vendor Page Anti C14orf79 pAb (ATL-HPA042052)