Anti C14orf39 pAb (ATL-HPA059518)

Atlas Antibodies

SKU:
ATL-HPA059518-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 14 open reading frame 39
Gene Name: C14orf39
Alternative Gene Name: SIX6OS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021098: 60%, ENSRNOG00000031655: 56%
Entrez Gene ID: 317761
Uniprot ID: Q8N1H7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYESQKLVRPIK
Gene Sequence EVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYESQKLVRPIK
Gene ID - Mouse ENSMUSG00000021098
Gene ID - Rat ENSRNOG00000031655
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C14orf39 pAb (ATL-HPA059518)
Datasheet Anti C14orf39 pAb (ATL-HPA059518) Datasheet (External Link)
Vendor Page Anti C14orf39 pAb (ATL-HPA059518) at Atlas Antibodies

Documents & Links for Anti C14orf39 pAb (ATL-HPA059518)
Datasheet Anti C14orf39 pAb (ATL-HPA059518) Datasheet (External Link)
Vendor Page Anti C14orf39 pAb (ATL-HPA059518)