Anti C14orf28 pAb (ATL-HPA059635)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059635-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C14orf28
Alternative Gene Name: DRIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047227: 92%, ENSRNOG00000023230: 89%
Entrez Gene ID: 122525
Uniprot ID: Q4W4Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCH |
Gene Sequence | LMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCH |
Gene ID - Mouse | ENSMUSG00000047227 |
Gene ID - Rat | ENSRNOG00000023230 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C14orf28 pAb (ATL-HPA059635) | |
Datasheet | Anti C14orf28 pAb (ATL-HPA059635) Datasheet (External Link) |
Vendor Page | Anti C14orf28 pAb (ATL-HPA059635) at Atlas Antibodies |
Documents & Links for Anti C14orf28 pAb (ATL-HPA059635) | |
Datasheet | Anti C14orf28 pAb (ATL-HPA059635) Datasheet (External Link) |
Vendor Page | Anti C14orf28 pAb (ATL-HPA059635) |