Anti C14orf28 pAb (ATL-HPA059635)

Atlas Antibodies

Catalog No.:
ATL-HPA059635-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 14 open reading frame 28
Gene Name: C14orf28
Alternative Gene Name: DRIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047227: 92%, ENSRNOG00000023230: 89%
Entrez Gene ID: 122525
Uniprot ID: Q4W4Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCH
Gene Sequence LMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCH
Gene ID - Mouse ENSMUSG00000047227
Gene ID - Rat ENSRNOG00000023230
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C14orf28 pAb (ATL-HPA059635)
Datasheet Anti C14orf28 pAb (ATL-HPA059635) Datasheet (External Link)
Vendor Page Anti C14orf28 pAb (ATL-HPA059635) at Atlas Antibodies

Documents & Links for Anti C14orf28 pAb (ATL-HPA059635)
Datasheet Anti C14orf28 pAb (ATL-HPA059635) Datasheet (External Link)
Vendor Page Anti C14orf28 pAb (ATL-HPA059635)