Anti C14orf166 pAb (ATL-HPA039824)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039824-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: C14orf166
Alternative Gene Name: CGI-99, CLE, CLE7, LCRP369, RLLM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021807: 97%, ENSRNOG00000000340: 97%
Entrez Gene ID: 51637
Uniprot ID: Q9Y224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS |
| Gene Sequence | ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS |
| Gene ID - Mouse | ENSMUSG00000021807 |
| Gene ID - Rat | ENSRNOG00000000340 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C14orf166 pAb (ATL-HPA039824) | |
| Datasheet | Anti C14orf166 pAb (ATL-HPA039824) Datasheet (External Link) |
| Vendor Page | Anti C14orf166 pAb (ATL-HPA039824) at Atlas Antibodies |
| Documents & Links for Anti C14orf166 pAb (ATL-HPA039824) | |
| Datasheet | Anti C14orf166 pAb (ATL-HPA039824) Datasheet (External Link) |
| Vendor Page | Anti C14orf166 pAb (ATL-HPA039824) |
| Citations for Anti C14orf166 pAb (ATL-HPA039824) – 1 Found |
| Jurkin, Jennifer; Henkel, Theresa; Nielsen, Anne Færch; Minnich, Martina; Popow, Johannes; Kaufmann, Therese; Heindl, Katrin; Hoffmann, Thomas; Busslinger, Meinrad; Martinez, Javier. The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells. The Embo Journal. 2014;33(24):2922-36. PubMed |