Anti C14orf166 pAb (ATL-HPA039824)

Atlas Antibodies

Catalog No.:
ATL-HPA039824-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 14 open reading frame 166
Gene Name: C14orf166
Alternative Gene Name: CGI-99, CLE, CLE7, LCRP369, RLLM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021807: 97%, ENSRNOG00000000340: 97%
Entrez Gene ID: 51637
Uniprot ID: Q9Y224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
Gene Sequence ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
Gene ID - Mouse ENSMUSG00000021807
Gene ID - Rat ENSRNOG00000000340
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C14orf166 pAb (ATL-HPA039824)
Datasheet Anti C14orf166 pAb (ATL-HPA039824) Datasheet (External Link)
Vendor Page Anti C14orf166 pAb (ATL-HPA039824) at Atlas Antibodies

Documents & Links for Anti C14orf166 pAb (ATL-HPA039824)
Datasheet Anti C14orf166 pAb (ATL-HPA039824) Datasheet (External Link)
Vendor Page Anti C14orf166 pAb (ATL-HPA039824)
Citations for Anti C14orf166 pAb (ATL-HPA039824) – 1 Found
Jurkin, Jennifer; Henkel, Theresa; Nielsen, Anne Færch; Minnich, Martina; Popow, Johannes; Kaufmann, Therese; Heindl, Katrin; Hoffmann, Thomas; Busslinger, Meinrad; Martinez, Javier. The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells. The Embo Journal. 2014;33(24):2922-36.  PubMed