Anti C14orf166 pAb (ATL-HPA039824)

Atlas Antibodies

SKU: ATL-HPA039824-25

• 
• 
• 

Protein Description: chromosome 14 open reading frame 166
Gene Name: C14orf166
Alternative Gene Name: CGI-99, CLE, CLE7, LCRP369, RLLM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021807: 97%, ENSRNOG00000000340: 97%
Entrez Gene ID: 51637
Uniprot ID: Q9Y224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
• Gene Sequence: ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
• Gene ID - Mouse: ENSMUSG00000021807
• Gene ID - Rat: ENSRNOG00000000340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C14orf166 pAb (ATL-HPA039824) – 1 Found

Jurkin, Jennifer; Henkel, Theresa; Nielsen, Anne Færch; Minnich, Martina; Popow, Johannes; Kaufmann, Therese; Heindl, Katrin; Hoffmann, Thomas; Busslinger, Meinrad; Martinez, Javier. The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells. The Embo Journal. 2014;33(24):2922-36.