Anti C14orf159 pAb (ATL-HPA052932)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052932-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: C14orf159
Alternative Gene Name: FLJ39975
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021185: 87%, ENSRNOG00000004442: 87%
Entrez Gene ID: 80017
Uniprot ID: Q7Z3D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVEQGVLKTQIPILTYQGGSVEAAQAFLCKNGDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDG |
| Gene Sequence | AVEQGVLKTQIPILTYQGGSVEAAQAFLCKNGDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDG |
| Gene ID - Mouse | ENSMUSG00000021185 |
| Gene ID - Rat | ENSRNOG00000004442 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C14orf159 pAb (ATL-HPA052932) | |
| Datasheet | Anti C14orf159 pAb (ATL-HPA052932) Datasheet (External Link) |
| Vendor Page | Anti C14orf159 pAb (ATL-HPA052932) at Atlas Antibodies |
| Documents & Links for Anti C14orf159 pAb (ATL-HPA052932) | |
| Datasheet | Anti C14orf159 pAb (ATL-HPA052932) Datasheet (External Link) |
| Vendor Page | Anti C14orf159 pAb (ATL-HPA052932) |