Anti C14orf159 pAb (ATL-HPA041423)

Atlas Antibodies

SKU: ATL-HPA041423-25

• 
• 
• 

Protein Description: chromosome 14 open reading frame 159
Gene Name: C14orf159
Alternative Gene Name: FLJ39975
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021185: 72%, ENSRNOG00000004442: 74%
Entrez Gene ID: 80017
Uniprot ID: Q7Z3D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA
• Gene Sequence: AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA
• Gene ID - Mouse: ENSMUSG00000021185
• Gene ID - Rat: ENSRNOG00000004442
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C14orf159 pAb (ATL-HPA041423) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.