Anti C14orf119 pAb (ATL-HPA003638 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003638-25
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C14orf119 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413438).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 14 open reading frame 119
Gene Name: C14orf119
Alternative Gene Name: FLJ20671
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040822: 84%, ENSRNOG00000029146: 83%
Entrez Gene ID: 55017
Uniprot ID: Q9NWQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQ
Gene Sequence SLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQ
Gene ID - Mouse ENSMUSG00000040822
Gene ID - Rat ENSRNOG00000029146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C14orf119 pAb (ATL-HPA003638 w/enhanced validation)
Datasheet Anti C14orf119 pAb (ATL-HPA003638 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C14orf119 pAb (ATL-HPA003638 w/enhanced validation)



Citations for Anti C14orf119 pAb (ATL-HPA003638 w/enhanced validation) – 2 Found
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed
Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48.  PubMed