Anti C12orf76 pAb (ATL-HPA039713 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039713-25

• 
• 
• 

Protein Description: chromosome 12 open reading frame 76
Gene Name: C12orf76
Alternative Gene Name: FLJ40142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033705: 30%, ENSRNOG00000020293: 27%
Entrez Gene ID: 400073
Uniprot ID: Q8N812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ
• Gene Sequence: AELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ
• Gene ID - Mouse: ENSMUSG00000033705
• Gene ID - Rat: ENSRNOG00000020293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.