Anti C12orf73 pAb (ATL-HPA038883)

Atlas Antibodies

Catalog No.:
ATL-HPA038883-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 73
Gene Name: C12orf73
Alternative Gene Name: DKFZp547P055, FLJ13975
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063320: 80%, ENSRNOG00000026982: 74%
Entrez Gene ID: 728568
Uniprot ID: Q69YU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
Gene Sequence AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
Gene ID - Mouse ENSMUSG00000063320
Gene ID - Rat ENSRNOG00000026982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C12orf73 pAb (ATL-HPA038883)
Datasheet Anti C12orf73 pAb (ATL-HPA038883) Datasheet (External Link)
Vendor Page Anti C12orf73 pAb (ATL-HPA038883) at Atlas Antibodies

Documents & Links for Anti C12orf73 pAb (ATL-HPA038883)
Datasheet Anti C12orf73 pAb (ATL-HPA038883) Datasheet (External Link)
Vendor Page Anti C12orf73 pAb (ATL-HPA038883)