Anti C12orf73 pAb (ATL-HPA038883)

Atlas Antibodies

Catalog No.: ATL-HPA038883-25

Protein Description: chromosome 12 open reading frame 73
Gene Name: C12orf73
Alternative Gene Name: DKFZp547P055, FLJ13975
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063320: 80%, ENSRNOG00000026982: 74%
Entrez Gene ID: 728568
Uniprot ID: Q69YU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
• Gene Sequence: AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
• Gene ID - Mouse: ENSMUSG00000063320
• Gene ID - Rat: ENSRNOG00000026982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.