Anti C12orf65 pAb (ATL-HPA038194)

Atlas Antibodies

Catalog No.:
ATL-HPA038194-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 65
Gene Name: C12orf65
Alternative Gene Name: FLJ38663, SPG55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047635: 71%, ENSRNOG00000001073: 71%
Entrez Gene ID: 91574
Uniprot ID: Q9H3J6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNC
Gene Sequence GLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNC
Gene ID - Mouse ENSMUSG00000047635
Gene ID - Rat ENSRNOG00000001073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C12orf65 pAb (ATL-HPA038194)
Datasheet Anti C12orf65 pAb (ATL-HPA038194) Datasheet (External Link)
Vendor Page Anti C12orf65 pAb (ATL-HPA038194) at Atlas Antibodies

Documents & Links for Anti C12orf65 pAb (ATL-HPA038194)
Datasheet Anti C12orf65 pAb (ATL-HPA038194) Datasheet (External Link)
Vendor Page Anti C12orf65 pAb (ATL-HPA038194)