Anti C12orf60 pAb (ATL-HPA043911)

Atlas Antibodies

SKU:
ATL-HPA043911-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 60
Gene Name: C12orf60
Alternative Gene Name: MGC47869
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047515: 48%, ENSRNOG00000027979: 42%
Entrez Gene ID: 144608
Uniprot ID: Q5U649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSKTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFKKASD
Gene Sequence SSKTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFKKASD
Gene ID - Mouse ENSMUSG00000047515
Gene ID - Rat ENSRNOG00000027979
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C12orf60 pAb (ATL-HPA043911)
Datasheet Anti C12orf60 pAb (ATL-HPA043911) Datasheet (External Link)
Vendor Page Anti C12orf60 pAb (ATL-HPA043911) at Atlas Antibodies

Documents & Links for Anti C12orf60 pAb (ATL-HPA043911)
Datasheet Anti C12orf60 pAb (ATL-HPA043911) Datasheet (External Link)
Vendor Page Anti C12orf60 pAb (ATL-HPA043911)