Anti C12orf57 pAb (ATL-HPA066043)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066043-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C12orf57
Alternative Gene Name: C10, GRCC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072772: 97%, ENSRNOG00000050660: 97%
Entrez Gene ID: 113246
Uniprot ID: Q99622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSV |
| Gene Sequence | EVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSV |
| Gene ID - Mouse | ENSMUSG00000072772 |
| Gene ID - Rat | ENSRNOG00000050660 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C12orf57 pAb (ATL-HPA066043) | |
| Datasheet | Anti C12orf57 pAb (ATL-HPA066043) Datasheet (External Link) |
| Vendor Page | Anti C12orf57 pAb (ATL-HPA066043) at Atlas Antibodies |
| Documents & Links for Anti C12orf57 pAb (ATL-HPA066043) | |
| Datasheet | Anti C12orf57 pAb (ATL-HPA066043) Datasheet (External Link) |
| Vendor Page | Anti C12orf57 pAb (ATL-HPA066043) |