Anti C12orf57 pAb (ATL-HPA066043)

Atlas Antibodies

SKU:
ATL-HPA066043-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 57
Gene Name: C12orf57
Alternative Gene Name: C10, GRCC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072772: 97%, ENSRNOG00000050660: 97%
Entrez Gene ID: 113246
Uniprot ID: Q99622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSV
Gene Sequence EVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSV
Gene ID - Mouse ENSMUSG00000072772
Gene ID - Rat ENSRNOG00000050660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C12orf57 pAb (ATL-HPA066043)
Datasheet Anti C12orf57 pAb (ATL-HPA066043) Datasheet (External Link)
Vendor Page Anti C12orf57 pAb (ATL-HPA066043) at Atlas Antibodies

Documents & Links for Anti C12orf57 pAb (ATL-HPA066043)
Datasheet Anti C12orf57 pAb (ATL-HPA066043) Datasheet (External Link)
Vendor Page Anti C12orf57 pAb (ATL-HPA066043)