Anti C12orf54 pAb (ATL-HPA073090)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073090-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C12orf54
Alternative Gene Name: MGC35033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099353: 61%,
Entrez Gene ID: 121273
Uniprot ID: Q6X4T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR |
Gene Sequence | MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR |
Gene ID - Mouse | ENSMUSG00000099353 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C12orf54 pAb (ATL-HPA073090) | |
Datasheet | Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link) |
Vendor Page | Anti C12orf54 pAb (ATL-HPA073090) at Atlas Antibodies |
Documents & Links for Anti C12orf54 pAb (ATL-HPA073090) | |
Datasheet | Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link) |
Vendor Page | Anti C12orf54 pAb (ATL-HPA073090) |