Anti C12orf49 pAb (ATL-HPA026905)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026905-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C12orf49
Alternative Gene Name: FLJ21415
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032840: 91%, ENSRNOG00000001123: 91%
Entrez Gene ID: 79794
Uniprot ID: Q9H741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSS |
| Gene Sequence | NLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSS |
| Gene ID - Mouse | ENSMUSG00000032840 |
| Gene ID - Rat | ENSRNOG00000001123 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C12orf49 pAb (ATL-HPA026905) | |
| Datasheet | Anti C12orf49 pAb (ATL-HPA026905) Datasheet (External Link) |
| Vendor Page | Anti C12orf49 pAb (ATL-HPA026905) at Atlas Antibodies |
| Documents & Links for Anti C12orf49 pAb (ATL-HPA026905) | |
| Datasheet | Anti C12orf49 pAb (ATL-HPA026905) Datasheet (External Link) |
| Vendor Page | Anti C12orf49 pAb (ATL-HPA026905) |